Semaglutide is a modified peptide derived from glucagon-like peptide-1 (GLP-1), a naturally occurring hormone involved in metabolic signaling. Its molecular structure contains 31 amino acid residues, along with several chemical modifications that distinguish it from native GLP-1.
These modifications are important in peptide research because they affect enzymatic stability, protein binding, and molecular interactions with the GLP-1 receptor.
But what exactly makes semaglutide different from natural GLP-1?
This article examines the semaglutide peptide structure, its amino acid sequence, molecular formula, and three major chemical modifications. It also explains how researchers characterize the compound using analytical techniques such as high-performance liquid chromatography (HPLC) and mass spectrometry.
For a broader scientific reference, see the Semaglutide compound profile in Orion Peptides’ research library.
What Is the Molecular Structure of Semaglutide?
Semaglutide is a lipid-modified GLP-1 analog. Its peptide backbone is based on the biologically active GLP-1(7–37) sequence, which contains 31 amino acid residues.
The molecule preserves most of the native GLP-1 sequence but incorporates specific changes intended to alter its biochemical properties.
Semaglutide Chemical Properties
| Property | Value |
|---|---|
| Compound name | Semaglutide |
| Molecular formula | C₁₈₇H₂₉₁N₄₅O₅₉ |
| Molecular weight | Approximately 4,113.58 g/mol |
| Amino acid residues | 31 |
| CAS number | 910463-68-2 |
| PubChem CID | 56843331 |
| Molecular classification | Modified peptide / lipopeptide |
| Primary receptor target | GLP-1 receptor |
The molecular formula and chemical identifiers are documented in the PubChem semaglutide database.
Unlike an unmodified peptide chain, semaglutide contains a fatty diacid side chain attached through a chemical linker. This additional structure contributes substantially to its molecular weight and physicochemical behavior.
Semaglutide Amino Acid Sequence Explained
The semaglutide amino acid sequence closely resembles the natural GLP-1(7–37) peptide.
The sequence can be represented as:
H–Aib–EGTFTSDVSSYLEGQAAK*EFIAWLVRGRG
In this notation:
- H represents histidine at the N-terminus.
- Aib represents alpha-aminoisobutyric acid, a nonstandard amino acid.
- K* represents lysine carrying the lipid-containing side chain.
- The remaining letters represent conventional amino acid residues.
This notation describes the peptide backbone but does not fully display the chemical structure of the linker and C18 fatty diacid.
The corresponding native GLP-1(7–37) sequence is:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Comparing the two sequences reveals two amino acid substitutions. The third major modification is the lipid attachment at lysine.
A detailed discussion of the sequence and engineered substitutions appears in the peer-reviewed paper Design and Biosynthesis of Ornithine 8-Containing Semaglutide Variants, published in ACS Synthetic Biology.
Understanding Amino Acid Numbering
Scientific publications commonly use the original GLP-1 residue numbering system.
For example, the modified residue called position 8 in GLP-1 numbering is the second residue of semaglutide’s 31-residue chain.
Similarly, lysine-26 is the twentieth residue in the isolated peptide sequence.
This distinction is important when comparing chemical structures, sequence diagrams, and research papers.
Three Major Molecular Modifications in Semaglutide
Semaglutide’s structure differs from native GLP-1 through three principal modifications.
1. Alanine Replacement With Alpha-Aminoisobutyric Acid (Aib)
Natural GLP-1 contains alanine at position 8.
In semaglutide, this alanine is replaced with alpha-aminoisobutyric acid (Aib), a nonproteinogenic amino acid.
The substitution is significant because native GLP-1 is susceptible to cleavage by dipeptidyl peptidase-4 (DPP-4), an enzyme that recognizes and breaks down certain peptide sequences.
Introducing Aib at this position reduces susceptibility to DPP-4-mediated cleavage.
From a molecular engineering perspective, the substitution illustrates how replacing a single amino acid can influence peptide stability without requiring extensive changes to the overall sequence.
The modification is described in the FDA’s semaglutide chemistry review.
2. C18 Fatty Diacid Attachment at Lysine-26
One of the most distinctive features of the semaglutide molecular structure is its lipid-containing side chain.
A C18 fatty diacid is attached to lysine at position 26 through a linker that includes gamma-glutamic acid and hydrophilic spacer units.
This process is known as lipidation or fatty acid acylation.
The attached side chain changes the compound’s interactions with surrounding molecules, particularly albumin.
Albumin is a major protein found in blood plasma. The fatty diacid modification promotes reversible association with albumin, contributing to semaglutide’s prolonged biological persistence.
This makes semaglutide an important example of how lipid conjugation can alter peptide pharmacokinetics.
Researchers studying lipidated peptides often investigate several related properties:
- Protein-binding affinity
- Molecular stability
- Receptor accessibility
- Solubility and aggregation behavior
- Chemical integrity of the lipid linker
These properties must be evaluated experimentally because modifying one molecular characteristic can influence several others.
3. Lysine-to-Arginine Substitution at Position 34
The third modification occurs at position 34 of the GLP-1 sequence.
Native GLP-1 contains lysine at this position, whereas semaglutide contains arginine.
Both amino acids carry positively charged side chains under many physiological conditions, but their chemical structures differ.
The substitution helps direct the lipid-conjugation chemistry toward the intended lysine-26 attachment site.
Without this modification, additional reactive amino groups could complicate selective peptide modification during manufacturing.
This illustrates another principle of peptide engineering: amino acid substitutions can be introduced to improve chemical selectivity during synthesis, not simply to change receptor activity.
Semaglutide vs Natural GLP-1: Structural Comparison
| Feature | Natural GLP-1(7–37) | Semaglutide |
|---|---|---|
| Peptide length | 31 residues | 31 residues |
| Position 8 | Alanine | Aib |
| Position 26 | Unmodified lysine | Lipid-modified lysine |
| Position 34 | Lysine | Arginine |
| C18 fatty diacid | Absent | Present |
| DPP-4 susceptibility | High | Reduced |
| Albumin association | Limited | Enhanced through lipidation |
Although both molecules interact with the GLP-1 receptor, their structural differences produce distinct biochemical and pharmacokinetic characteristics.
Semaglutide is therefore not simply an identical copy of natural GLP-1. It is a chemically engineered analog designed around the native peptide’s receptor-binding architecture.
How Does Semaglutide Interact With the GLP-1 Receptor?
The GLP-1 receptor belongs to the class B family of G protein-coupled receptors (GPCRs).
These receptors participate in cellular signaling by responding to extracellular ligands.
When a compatible ligand binds, the receptor can undergo conformational changes that influence intracellular signaling pathways.
Semaglutide retains the ability to activate the GLP-1 receptor despite its amino acid substitutions and lipid modification.
This makes it useful in scientific investigations of:
- Peptide–receptor recognition
- Ligand-binding interactions
- GPCR conformational changes
- Intracellular signaling pathways
- Structure–activity relationships
- Peptide engineering and molecular stability
The relationship between semaglutide’s chemical design and receptor pharmacology is discussed in the FDA’s published chemistry and quality assessment.
Why Is Semaglutide Considered a Lipidated Peptide?
A lipidated peptide is a peptide chemically linked to a lipid-containing group.
Lipidation is used in peptide engineering to modify properties that are not determined by the amino acid sequence alone.
Semaglutide contains a C18 fatty diacid attached to its peptide backbone through a linker.
The hydrophilic spacer separates the fatty diacid from the peptide chain and contributes to the arrangement of the modified molecule.
This structural design allows researchers to study the relationship between peptide sequence, lipid conjugation, protein association, and receptor interactions.
Lipidated peptides are also studied for their behavior in different analytical environments, including their solubility, aggregation, and interactions with laboratory materials.
How Researchers Verify Semaglutide’s Molecular Identity
Confirming a peptide’s identity requires more than reading the compound name or checking the amount printed on a vial.
Laboratories commonly use complementary analytical methods to characterize research compounds.
High-Performance Liquid Chromatography (HPLC)
HPLC separates components in a sample based on their interactions with the chromatography system.
Researchers use HPLC to evaluate chromatographic purity and detect certain related substances or degradation compounds.
However, an HPLC purity result alone does not establish the full molecular identity of semaglutide.
Mass Spectrometry (MS)
Mass spectrometry measures mass-to-charge ratios and can help confirm whether a sample’s molecular mass is consistent with the expected compound.
For semaglutide, the expected molecular weight is approximately 4,113.58 g/mol.
Additional analytical approaches, including tandem mass spectrometry or peptide mapping, can provide more detailed structural information when appropriate.
Certificate of Analysis (COA)
A certificate of analysis may summarize identity, purity, assay, and other batch-specific measurements.
Researchers should review the actual test methods, batch identifiers, analytical results, and stated acceptance criteria.
Orion Peptides provides research-compound information and batch documentation through its website and COA library.
For an example of a compound-specific compound listing with analytical information, see Semaglutide 10mg at Orion Peptides.
Analytical results should always be interpreted within the scope of the testing performed. A chromatographic purity result does not, by itself, establish sterility, safety, or suitability for human administration.
Why Molecular Modifications Matter in Peptide Research
Peptides are built from amino acid sequences, but their behavior depends on more than sequence length.
Researchers also consider side-chain chemistry, secondary structure, terminal groups, molecular charge, solubility, and interactions with other molecules.
Semaglutide demonstrates how multiple structural modifications can be combined within one peptide.
Its Aib substitution influences susceptibility to enzymatic cleavage. The C18 fatty diacid affects albumin association, while the arginine substitution helps control site-selective lipidation.
Together, these changes provide a useful case study in rational peptide design.
For researchers examining related compounds, Orion’s Semaglutide research profile provides additional background on the compound’s chemical identity and molecular characteristics.
Frequently Asked Questions
How many amino acids are in semaglutide?
Semaglutide contains 31 amino acid residues in its peptide backbone, including the nonstandard amino acid alpha-aminoisobutyric acid.
What is the molecular formula of semaglutide?
The molecular formula is C₁₈₇H₂₉₁N₄₅O₅₉, which includes the peptide backbone and its attached chemical modifications.
What is the molecular weight of semaglutide?
Its molecular weight is approximately 4,113.58 g/mol, commonly rounded to 4,114 g/mol.
Is semaglutide identical to natural GLP-1?
No. Semaglutide is a modified GLP-1 analog containing two amino acid substitutions and a lipid-containing side chain.
What is Aib in the semaglutide sequence?
Aib stands for alpha-aminoisobutyric acid. It replaces alanine at GLP-1 position 8 and reduces susceptibility to degradation by DPP-4.
Why does semaglutide contain a C18 fatty diacid?
The C18 fatty diacid promotes reversible association with albumin and contributes to the compound’s prolonged biological persistence.
What is the difference between semaglutide sequence and semaglutide structure?
The sequence describes the order of amino acid residues. The complete molecular structure also includes the lipid linker, fatty diacid group, chemical bonds, and three-dimensional arrangement.
Conclusion
The semaglutide peptide structure provides an example of how targeted molecular modifications can change the properties of a naturally occurring peptide.
Semaglutide retains a 31-residue backbone based on GLP-1(7–37), but differs through an Aib substitution at position 8, a lipid-modified lysine at position 26, and an arginine substitution at position 34.
These features are central to understanding its chemical identity, enzymatic stability, albumin association, and receptor interactions.
For further information, explore the Orion Peptides Semaglutide research reference and the company’s research peptide catalog.
Research-use notice: This article is provided for scientific education. Research compounds sold by Orion Peptides are intended for laboratory research only and are not intended for human or veterinary use.
Scientific References
- PubChem — Semaglutide, CID 56843331. National Center for Biotechnology Information. Molecular formula, identifiers, and chemical classification.
- FDA — Semaglutide Chemistry Review. Chemical structure, peptide modifications, and molecular characterization.
- Design and Biosynthesis of Ornithine 8-Containing Semaglutide Variants. ACS Synthetic Biology, 2025. Structural design and modified peptide chemistry.
- In Silico Immunogenicity Assessment for Sequences Containing Unnatural Amino Acids. Discussion of semaglutide’s nonstandard amino acid and lipid modifications.
- DailyMed — Wegovy (Semaglutide) Prescribing Information. Regulatory reference for molecular description and pharmacology.
