TB-500 is an artificial peptide fragment. It was developed through modification of the naturally occurring protein thymosin beta-4 (Tβ4). Tβ4 is a 43-amino-acid polypeptide which is highly conserved in mammals and serves many important biological functions such as differentiation, remodelling and wound healing. The discovery of Tβ4 in the 1960s kicked off a line of scientific research that eventually resulted in the development of TB-500 as a research compound.
This blog covers the scientific history of TB-500 from its discovery in the thymus extracts to the present day, where it is the subject of scientific research on tissue regeneration and repair.
The Early Years: Research on Thymus Extract
TB-500’s history begins in the early 1900’s with the investigation of thymus extracts. Crude extracts of calf thymus were prepared in Europe in the early to mid-1900s and named “thymomodulin” or “thymic hormones”. At that time, the precise function of the thymus was not well understood, although it was known to be prominent in youth and to regress with age. Some researchers speculated about its role in maintaining youthfulness and healing capacity.
They were cell-free acid lysates of early thymus containing hundreds to thousands of active and inactive proteins. Such biological extracts were variable and difficult to standardize by contemporary research standards.
The Discovery of Thymosin
Significant advances were made in the 1960’s by Dr. Allan Goldstein, who isolated and identified specific peptides from thymus tissue and created a family of compounds called thymosins. While Thymosin Alpha-1 was created to study immune cell activity, it was the later discovery of Thymosin Beta-4 that would ultimately gain the interest of researchers interested in tissue repair.
Thymosin Beta-4 is a member of the beta-thymosin family of highly conserved small peptides (40-60 amino acids) originally isolated from calf thymus.
The β-thymosins have isoelectric points ranging approximately from pH 5.0–7.0 and are a group of several highly homologous peptides with overlapping functions in tissue regeneration and recovery.
Molecular Characterisation of Thymosin Beta-4
Full-length Tβ4 is composed of 43 amino acids with the sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES. Its N-terminus is naturally acetylated, a post-translational modification that enhances the stability inside the cell.
Key structural features are:
- Actin-binding domain: The LKKTETQ sequence (residues 17–23) was identified as the conserved actin-binding domain required for G-actin sequestration. This domain allows Tβ4 to bind G-actin in a 1:1 ratio, blocking its polymerization to F-actin, and preserving a pool of actin monomers required for cell motility.
- Ubiquitous Expression: Tβ4 is constitutively expressed in virtually all mammalian cells, the highest concentrations being found in platelets, leukocytes, and plasma. It is released from activated platelets at sites of injury, acting as a damage-associated molecular pattern that orchestrates early wound-healing responses.
The Rise of TB-500 Peptide
As research into Tβ4 progressed, scientists sought to develop synthetic fragments that would retain the core bioactivities of the parent molecule, but with the added benefits of improved stability and tissue penetration. This led to the development of TB-500, a synthetic peptide fragment of seven amino acids corresponding to the actin-binding domain of Tβ4.
Use of TB-500 in Equine Sports Research and in Doping Detection
TB-500 initially received attention within the realm of equine sports. There is a veterinary compound called TB-500 that was found to contain the synthetic form of the peptide LKKTETQ with an N-terminal modification.
This substance was investigated for its possible effects on endothelial cell differentiation, angiogenesis, keratinocyte migration, collagen deposition, and reduced inflammation.
As TB-500 began being used in research on equine athletes, detection of this substance became necessary. In 2012, researchers from the Hong Kong Jockey Club developed a technique for detecting N-acetylated LKKTETQ and its derivatives in equine urine and plasma.
Human Research, Clinical Trials, and Safety Profile
Human clinical trials have been conducted using whole-length thymosin beta-4 protein, not the peptide TB-500. Phase 1 safety trial examined the safety profile of single and repeat doses of thymosin β4 in healthy participants. Healthy participants were administered an intravenous dose of 42 mg to 1260 mg. There was little incidence of mild and reversible side effects; there were no serious side effects, dose-limiting toxicity, or mortality.
A placebo-controlled clinical trial involving subjects with venous stasis ulcers studied the use of Tβ4 gel. The trial did not show any significant benefit of any dose in wound healing. Relevant clinical trials for TB-500 are lacking.
Regulations of the FDA on Peptides and Restrictions in Athletics
Though widely used in the laboratory environment, the international regulations concerning TB-500 have become quite strict nowadays. In the United States, the FDA has placed the Thymosin Beta-4 Fragment (LKKTETQ) on the List of Category 2 Bulk Drug Substances. This is because there is no officially collected human clinical trial safety data about this peptide, and that is why any compounding pharmacy is not allowed to produce or distribute it.
Moreover, the WADA and USADA categorically prohibit the use of TB-500 in the S2 category (Peptide Hormones, Growth Factors, Related Substances, and Mimetics). The restriction concerns all competitors both in and out of competition since the peptide helps to stimulate recovery artificially with the help of synthetic tissue remodeling. Thus, the substance is available only through research chemicals.
TB-500 Mechanism of Action and Cellular Signaling
Actin Cytoskeletal Dynamics and Structural Mobility
The TB-500 fragment is thought to retain the actin-binding property of the G-actin-binding site of Thymosin Beta-4 and affect the cytoskeleton and cell migration in experimental models. Experimental evidence indicates that the fragment might play a role in the remodeling of the cytoskeletal structure and bind to G-actin, but this interaction has been better characterised for full-length Thymosin Beta-4 compared to the isolated TB-500 fragment.
Importantly, TB-500 has a molecular weight of only ~889.0 g/mol, which is much less than that of full-length Tβ4 (~4963.5 g/mol), and therefore less steric hindrance. This smaller size in the laboratory models allows better tissue penetration and mobility of the molecules, so that there is a 1:1 binding of the active sequence on the monomeric G-actin with very high precision. This interaction prevents its polymerization into F-actin and keeps a pool of actin monomers in the cell that can readily polymerize to advance during cell migration to wounds.
Signaling Pathways and Tissue Regeneration
Several signaling pathways have been reported to be modulated by experimental studies with the TB-500 fragment and, to a greater extent, with full-length Thymosin Beta-4, such as VEGF, NF-κB, and PI3K/Akt:
- Pro-Angiogenic Signaling: Activation of the VEGF and related pathways in endothelial cells.
- Anti-Inflammatory Signaling: Inhibition of NF-κB activation and modulation of inflammatory cytokines.
- Pro-Survival Signaling: PI3K/Akt pathway.
Numerous of these effects have been more extensively described in the use of the full-length Thymosin Beta-4.
The Metabolite Revelation
There’s an interesting twist to the recent studies. It was also determined that TB-500 (Ac-LKKTETQ) is metabolized rapidly, with some of its metabolites being short-term (like Ac-LKKTE) and having activity in fibroblast wound-healing assays. Thus, it should be noted that some of the reported biological effects could be due to the downstream metabolites, not to the parent compound.
Current Research Scenario and Peptide Synergy
TB-500 continues to be studied in research settings for tissue regeneration, angiogenesis, ocular injury repair, and neurological recovery models. In 2025, research was published that investigated an alkaline phosphatase-activated peptide hydrogel with the TB-500 sequence for corneal injury repair, showing improved epithelial regeneration in animal models. Researchers are also still examining its contextual synergy in coadministration models with other regenerative peptides like BPC-157 to differentiate between systemic cell migration versus localized vascular growth.
TB-500 vs BPC-157: Comparative Breakdown
In regenerative medicine research, TB-500 is often compared to or stacked alongside BPC-157, i.e, a gastric-derived peptide. Both are studied for tissue recovery, but they use entirely different biological pathways:
| Characteristics | TB-500 (Ac-LKKTETQ) | BPC-157 (Pentadecapeptide) |
| Basic Mechanism | Binding of actin and cytoskeletal shifting | Upregulation of VEGFR2 & synthesis of nitric oxide |
| Core Action | Accelerates systemic cell migration to the injury | Accelerates localized angiogenesis (new blood vessels) |
| Target Strengths | Frequently investigated in muscles, skin, and eye research models. | Frequently investigated in tendons, ligaments, and gut research models. |
| Systemic Range | High tissue penetration due to ultra-low molecular weight | High localized impact, often binding tightly to regional tissues |
Frequently Asked Questions
1. What Is The Difference Between Thymosin Beta-4 & TB-500?
Thymosin Beta-4 is the full-length 43-amino-acid naturally occurring protein. TB-500 is a synthetic 7-amino-acid fragment (Ac-LKKTETQ) of the actin-binding domain. TB-500 retains the actin-regulating properties of the parent molecule but lacks additional functional domains found in full-length Tβ4.
These differences can be summarised in the table given below:
| Characteristics | Thymosin Beta-4 (Full-Length) | TB-500 (Fragment) |
| Sequence ofAmino Acid | Ac-SDKPDMAEIE…QAGES | Ac-LKKTETQ |
| Number of Amino Acids | 43 | 7 |
| Molecular Weight | ~4963.5 g/mol | ~889.0 g/mol |
| Molecular Formula | C₂₁₂H₃₅₀N₅₆O₇₈S | C₃₈H₆₈N₁₀O₁₄ |
2. How does TB-500 work?
Experimental studies have indicated that the TB-500 fragment maintains the biological activity of the actin-binding region of Thymosin Beta-4, which is associated with actin. It may be involved in the regulation of cytoskeletal dynamics, enhancement of cell motility, and supporting tissue repair processes in research models.
3. Has TB-500 been tested in human clinical trials?
Full-Length Thymosin Beta-4 has undergone clinical testing. There is limited comparable clinical data specific to the TB-500 fragment.
4. What’s the new research on TB-500 metabolism?
A 2024 study found that TB-500 is broken down into multiple fragments. Metabolites were shown to possess significant wound-healing activity in fibroblast assays, suggesting some of the biological effects may be mediated by metabolites rather than the parent compound.
5. Is TB-500 banned in sports?
Yes, TB-500 is banned by the WADA Prohibited List as a growth factor that impacts muscle, tendon, or ligament vascularisation and regenerative capacity. It falls into the categories S0 and S2.
6. TB-500 Nomenclature: Does It Contain 7 or 43 Amino Acids?
The commercial name TB-500 has been used inconsistently in the scientific literature. In most scientific investigations, it refers to the acetylated form of the protein sequence LKKTETQ at the N-terminus, corresponding to amino acids 17–23 of Thymosin Beta-4. However, in some commercial forms, it refers to synthetic Thymosin Beta-4 containing all 43 amino acids. Researchers need to be aware of this confusion when interpreting studies.
Disclaimer for Research Use Only (ROU)
Disclaimer: TB-500 (Ac-LKKTETQ) is regarded as a research compound only and is recommended for in vitro lab analysis and in vivo preclinical animal tests only. This compound is not FDA approved for human ingestion, diagnostics, therapy, or treatment of any condition or disease. According to FDA compounding regulations, Thymosin Beta-4 Fragment (LKKTETQ) falls into category 2 bulk drug substance, and therefore its human preparation and distribution by 503A compounding facilities are forbidden by law. In addition, the use of this substance by professional sportsmen is strictly prohibited by WADA in the S2 category.
References
2. Malinda KM, et al. Thymosin beta4 accelerates wound healing. J Invest Dermatol. 1999.
5. Ho ENM, et al. Doping control analysis of TB-500 in equine urine and plasma. J Chromatogr A. 2012.
