Vasoactive Intestinal Peptide (VIP) is a naturally occurring 28-amino-acid neuropeptide involved in several physiological processes, including neurotransmission, gastrointestinal function, vascular regulation, immune signaling, and circadian rhythm control.
Originally discovered in 1970, VIP has become an important subject of molecular and biomedical research because it acts as both a neurotransmitter and a signaling molecule in multiple organ systems.
Scientific investigations have explored its interactions with VPAC1 and VPAC2 receptors, intracellular signaling pathways, and potential roles in inflammatory and neurological conditions.
This article examines the molecular structure, biological functions, mechanisms of action, and current research surrounding VIP peptide.
What Is Vasoactive Intestinal Peptide (VIP)?
Vasoactive Intestinal Peptide belongs to the secretin/glucagon family of peptide hormones, which includes several molecules involved in endocrine and neurological signaling.
VIP was first isolated from porcine intestinal tissue by researchers Sami Said and Viktor Mutt in 1970. Its original name reflected its ability to influence vascular smooth muscle activity.
Subsequent research established that VIP is distributed throughout the:
- Central nervous system
- Peripheral nervous system
- Gastrointestinal tract
- Respiratory system
- Cardiovascular system
- Immune system
Despite its name, VIP is not limited to the intestine. It functions as a signaling molecule across numerous tissues and participates in interactions between neurological, endocrine, and immune pathways.
Research reference: Recent Advances in Vasoactive Intestinal Peptide Physiology and Pathophysiology.
VIP Peptide Molecular Structure and Chemical Properties
VIP is composed of 28 amino acids arranged in a linear peptide chain.
Its molecular structure is closely related to pituitary adenylate cyclase-activating polypeptide (PACAP), another peptide involved in neurological and endocrine signaling.
VIP Peptide Amino Acid Sequence
The human VIP peptide sequence is:
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
The peptide contains a C-terminal amide group, which contributes to its molecular characteristics and receptor interactions.
Chemical Characteristics of VIP
| Property | Description |
|---|---|
| Full name | Vasoactive Intestinal Peptide |
| Abbreviation | VIP |
| Peptide length | 28 amino acids |
| Classification | Neuropeptide and peptide hormone |
| Peptide family | Secretin/glucagon superfamily |
| Primary receptors | VPAC1 and VPAC2 |
| Signaling pathway | Adenylyl cyclase–cAMP–PKA |
| Natural distribution | Nervous, gastrointestinal, cardiovascular, and other tissues |
VIP can adopt alpha-helical conformations under particular molecular conditions, including interactions with membranes and receptors.
Its structural relationship with PACAP has made both compounds important subjects of comparative receptor pharmacology.
Research reference: VPAC Receptors: Structure, Molecular Pharmacology and Interaction With Accessory Proteins.
How Does VIP Peptide Work? Mechanism of Action
VIP primarily interacts with two G protein-coupled receptors:
- VPAC1 receptor
- VPAC2 receptor
These receptors belong to the class B family of G protein-coupled receptors (GPCRs).
Following VIP binding, receptor activation commonly stimulates the enzyme adenylyl cyclase, increasing intracellular concentrations of cyclic adenosine monophosphate (cAMP).
The resulting signaling cascade can activate protein kinase A (PKA) and influence various cellular processes.
VIP Receptor Signaling Pathway
The principal signaling sequence can be summarized as:
VIP → VPAC1/VPAC2 → Gs protein → Adenylyl cyclase → cAMP → PKA → Cellular responses
Depending on the receptor, cell type, and experimental conditions, these responses may influence:
- Smooth muscle activity
- Ion and fluid secretion
- Immune-cell signaling
- Neurotransmission
- Gene expression
- Endocrine regulation
Other intracellular pathways may also contribute to VIP-mediated responses.
The widespread expression of VPAC receptors helps explain why VIP participates in multiple physiological systems rather than a single biological function.
Research reference: Pharmacology and Functions of Receptors for VIP and PACAP — IUPHAR Review.
Biological Functions of VIP Peptide
1. VIP and Gastrointestinal Function
One of the most established research areas involving VIP is gastrointestinal physiology.
VIP is expressed in the enteric nervous system, where it contributes to communication between neurons, intestinal smooth muscle, and epithelial cells.
Experimental investigations have demonstrated its involvement in:
- Gastrointestinal smooth muscle relaxation
- Intestinal fluid and electrolyte secretion
- Pancreatic bicarbonate secretion
- Regulation of intestinal motility
- Enteric nervous system signaling
VIP-mediated signaling is particularly relevant to the coordination of digestive processes.
Researchers have also investigated changes in VIP signaling in experimental models of gastrointestinal dysfunction.
However, understanding these physiological mechanisms does not establish VIP as an approved treatment for gastrointestinal disease.
Research reference: Recent Advances in VIP Physiology: Focus on the Gastrointestinal System.
2. VIP Peptide and Immune System Research
VIP has attracted significant scientific attention because of its interactions with immune cells.
Research indicates that VIP can influence signaling in several immune-cell populations, including macrophages, dendritic cells, and T lymphocytes.
In experimental systems, VIP signaling has been associated with changes in:
- Pro-inflammatory cytokine production
- Anti-inflammatory signaling
- Immune-cell activation
- T-cell differentiation
- Communication between the nervous and immune systems
These findings have encouraged investigations into VIP’s immunomodulatory properties in models of inflammatory and autoimmune conditions.
Nevertheless, most proposed therapeutic applications remain investigational, and findings from laboratory or animal studies cannot automatically be translated into demonstrated human clinical benefits.
Research reference: Vasoactive Intestinal Peptide: A Neuropeptide With Pleiotropic Immune Functions.
3. VIP and the Nervous System
VIP functions as a neuropeptide within both the central and peripheral nervous systems.
It participates in neuronal communication and can influence the activity of specific neural circuits.
Research areas involving VIP include:
- Neuronal excitability
- Neurotransmitter signaling
- Neuroendocrine regulation
- Neuroimmune interactions
- Circadian rhythm regulation
One particularly important research area involves the suprachiasmatic nucleus (SCN), a region of the hypothalamus that coordinates circadian rhythms.
VIP signaling through VPAC2 receptors contributes to communication and synchronization among neurons within this biological clock network.
Animal studies have demonstrated that disruptions in VIP-related signaling can affect circadian rhythmicity.
These observations make VIP an important research molecule in the study of biological timing and neural network coordination.
Research reference: Pharmacology and Functions of VIP and PACAP Receptors.
4. VIP and Cardiovascular Signaling
VIP was originally identified because of its vascular effects.
Its interactions with vascular smooth muscle and endothelial signaling pathways have been examined in laboratory and physiological studies.
VIP-associated signaling may contribute to:
- Vascular smooth muscle relaxation
- Regulation of regional blood flow
- Cardiovascular autonomic signaling
- Interactions between neural and vascular systems
The degree of response varies according to tissue type, receptor expression, and experimental conditions.
These effects are physiologically important but do not establish that experimental VIP preparations are safe or effective cardiovascular treatments.
Research reference: Transmitter Role of Vasoactive Intestinal Peptide.
5. VIP and Respiratory System Research
VIP is also present in neural pathways associated with the respiratory system.
Research has investigated its interactions with airway smooth muscle, pulmonary blood vessels, and immune signaling within respiratory tissues.
Experimental areas of interest include airway relaxation, pulmonary vascular responses, and inflammatory signaling.
Although these mechanisms have generated interest in potential medical applications, further controlled clinical evidence is required to establish safety and efficacy for specific indications.
VIP Peptide vs PACAP: What Is the Difference?
VIP and pituitary adenylate cyclase-activating polypeptide (PACAP) are structurally related neuropeptides belonging to the same broad hormone family.
Both can interact with VPAC1 and VPAC2 receptors.
However, PACAP also interacts strongly with the PAC1 receptor, which is comparatively selective for PACAP.
| Feature | VIP | PACAP |
|---|---|---|
| Peptide family | Secretin/glucagon | Secretin/glucagon |
| Amino acids | 28 | 27 or 38 |
| Major receptors | VPAC1, VPAC2 | PAC1, VPAC1, VPAC2 |
| Neural signaling | Yes | Yes |
| Immune regulation research | Yes | Yes |
| Gastrointestinal research | Yes | Yes |
These differences in receptor affinity and signaling help researchers distinguish the biological roles of VIP and PACAP.
Research reference: IUPHAR Review: VIP and PACAP Receptor Pharmacology.
VIP Peptide Research: Current Evidence and Limitations
Although VIP has been studied for decades, important questions remain regarding its pharmacology and potential clinical applications.
Major research challenges include:
Peptide stability: VIP is susceptible to enzymatic degradation, creating challenges when studying its activity outside controlled biological environments.
Short biological half-life: Rapid degradation and clearance can complicate experimental studies involving systemic exposure.
Receptor distribution: VPAC receptors are expressed across multiple tissues, making tissue-specific biological responses difficult to isolate.
Clinical translation: Results obtained from cell cultures and animal models do not necessarily predict safety or efficacy in humans.
Formulation differences: Findings involving endogenous VIP, modified peptide analogues, or investigational pharmaceutical formulations cannot automatically be applied to commercially supplied research peptides.
These limitations are essential when interpreting published findings.
VIP Peptide for Laboratory Research
VIP continues to attract scientific attention because of its roles in neurotransmission, receptor pharmacology, immune regulation, and gastrointestinal physiology.
Laboratories investigating its molecular properties may require well-characterized peptide materials for controlled experimental studies.
Orion Peptides offers VIP (Vasoactive Intestinal Peptide) 5mg as a research-use-only compound, with compound specifications and batch analytical information available on the compound page.
Researchers should review the relevant Certificate of Analysis (COA), compound identity, analytical methods, and purity documentation when assessing materials for laboratory work.
The availability of a COA does not establish therapeutic efficacy, clinical safety, or FDA approval.
Frequently Asked Questions About VIP Peptide
What does VIP peptide stand for?
VIP stands for Vasoactive Intestinal Peptide, a naturally occurring neuropeptide involved in neurological, gastrointestinal, vascular, and immune signaling.
How many amino acids does VIP contain?
Human VIP contains 28 amino acids and belongs to the secretin/glucagon peptide hormone family.
What receptors does VIP activate?
VIP primarily interacts with VPAC1 and VPAC2 receptors, which are class B G protein-coupled receptors involved in intracellular signaling.
What is the main function of vasoactive intestinal peptide?
VIP has multiple biological functions, including smooth muscle regulation, gastrointestinal secretion, neurotransmission, and immune signaling. Its effects depend on the tissue and receptors involved.
Is VIP peptide the same as PACAP?
No. VIP and PACAP are related neuropeptides, but they differ in amino acid sequence and receptor interaction profiles.
Is VIP peptide FDA-approved?
VIP research preparations are not FDA-approved treatments. Specific investigational applications require appropriate regulatory evaluation, and research-only compounds should not be used for human or veterinary administration.
Conclusion
Vasoactive Intestinal Peptide (VIP) is a multifunctional 28-amino-acid neuropeptide with established physiological roles in nervous system communication, gastrointestinal regulation, vascular signaling, and immune-cell activity.
Its interactions with VPAC1 and VPAC2 receptors make it an important molecule for investigating GPCR signaling and the relationships between neurological, endocrine, and immune processes.
While experimental research continues to explore its biological properties, significant limitations remain regarding clinical translation, peptide stability, and potential therapeutic applications.
For laboratory investigations, researchers can review the specifications of VIP 5mg from Orion Peptides.
Scientific References
- Said SI, Mutt V. (1970). Polypeptide with Broad Biological Activity: Isolation From Small Intestine. Science.
Find original research on PubMed - IUPHAR Review (2012). Pharmacology and Functions of Receptors for Vasoactive Intestinal Peptide and Pituitary Adenylate Cyclase-Activating Polypeptide. British Journal of Pharmacology.
https://pubmed.ncbi.nlm.nih.gov/22289055/ - Delgado M, Ganea D. (2013). Vasoactive Intestinal Peptide: A Neuropeptide With Pleiotropic Immune Functions. Amino Acids.
https://pubmed.ncbi.nlm.nih.gov/22139413/ - Recent Advances in Vasoactive Intestinal Peptide Physiology and Pathophysiology: Focus on the Gastrointestinal System (2019).
https://pubmed.ncbi.nlm.nih.gov/31559013/ - VPAC Receptors: Structure, Molecular Pharmacology and Interaction With Accessory Proteins (2012). British Journal of Pharmacology.
https://pmc.ncbi.nlm.nih.gov/articles/PMC3415636/ - Mechanisms Involved in VPAC Receptor Activation and Regulation (2012). Frontiers in Endocrinology.
https://pmc.ncbi.nlm.nih.gov/articles/PMC3483716/ - Transmitter Role of Vasoactive Intestinal Peptide. Neurotransmitter and physiological signaling research.
https://pubmed.ncbi.nlm.nih.gov/8103215/
Research Disclaimer: This article is provided exclusively for scientific and educational purposes. Research-grade VIP peptides are not intended for human or veterinary consumption, diagnosis, prevention, or treatment of disease. Experimental findings should not be interpreted as evidence of clinical safety or effectiveness.
